PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.2021s0009.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HB-other
Protein Properties Length: 1123aa    MW: 127084 Da    PI: 8.0509
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.2021s0009.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox40.64.5e-13553856
                         -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         ++ q+++Le+++ +++yp+ +e+e+L k+lgLt + V+ WF+ rR + k
  Bostr.2021s0009.2.p  5 SPVQVQALEAFYLEQMYPTPKEMEDLGKSLGLTVKEVRGWFKRRRSRGK 53
                         788*******************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.216155IPR001356Homeobox domain
SMARTSM003893.6E-10159IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-12354IPR009057Homeodomain-like
SuperFamilySSF466898.98E-11354IPR009057Homeodomain-like
CDDcd000867.18E-12351No hitNo description
PfamPF000461.2E-10553IPR001356Homeobox domain
PROSITE profilePS5082712.185352411IPR018501DDT domain
SMARTSM005711.0E-9352411IPR018501DDT domain
PfamPF027913.0E-8355406IPR018501DDT domain
PfamPF156121.0E-7632672IPR028942WHIM1 domain
PfamPF156133.4E-11755828IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1123 aa     Download sequence    Send to blast
MKRKSPVQVQ ALEAFYLEQM YPTPKEMEDL GKSLGLTVKE VRGWFKRRRS RGKGVKSLAD  60
DGVGAENRQS YNKSRIRSST SSRCDFRAAV EKRCSVGLRK ANCQELLTSQ HILAKIFRKD  120
GPSLGSEFDH LPSGACKASW LGILSVDQQK QRVARKRKIS ELMDHTSQDC IEENATVVKH  180
GIGKGLMTVW RVMNPNGRDV SPCVDLLDER ATLPQSSARN PPHQKKRQKQ LASILKQKLL  240
QKRSTEKKRR SINREAELKK DESQRAFKEN CELAVDGKVF KETCQTISIL VDDEELEMRE  300
RQERGNPLTC SFHHPSSGSH GCFLCKDLLP KFPPNSVQMR VPFGLHPWNS SPEPVKKLFK  360
VVHFLYTYSV NLDICPFTLD EFTRAFHDKD SLLLGKIHLS LLKLLLLDVE TELQRGSFSN  420
LSISCKFLAL LQSVESQILI LDLWKDSLNS LTWTEILRQI LVAAGYGSVK CAVQSEELSK  480
ERRLMKKYGL RLGTLKGELF KILNEQGNNG LKISELANAP EVAVLNLGTA QEERENSICS  540
TLASDITLFE KISESTYRVR VNCFSEDPDK SQSVSDESGS VDDESDDCSI SSGDEIEHVS  600
ENPARRKVKC RKKRKHKSKM REVCSEIDES HPGEPWLLGL MEGEYSDLSI EEKLDVFVAL  660
IDLLSSGSTI RMEDLPRAMV DCAPSIYSHG SGGKIKRSSS NQYSYPRGSW VHGGELHGIK  720
ALFKSSDSHP VDSSSIVGAF AKLAADKANN VHPMQSVYLG SDRRFNRYWL FLGPCNANDP  780
GHRCVFFESS EDGHWEVINN KEALRALLSV LDDRGRREAR LIESLEKRES YLCQAMLSRQ  840
VTQLETAHFT DIVREDSSSP VSDIDNNLCL SDVANDQFSS HHAAIVFEIG SKREKSLLWS  900
LIQEFDEWIW ANFNFNLNAV KHRRRSYLDS LTRCKSCHDL YWRDEKHCKI CHATFEVDID  960
LEERYAIHAA TCRRKEECDT YPDHKVLSSQ LQSLKAAVYA IESAMPEDAL IGVWRKSAHR  1020
LWAKRLRRSS TVSEITQVIG DFVGAINEDW LWHSSDQGHS NASMGETISC FPSMPQTTSA  1080
LALWLVKLDT LIAPYVEKAQ PERNQLLCRT RNTSRRASTL QL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1221229PHQKKRQKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0496400.0AL049640.1 Arabidopsis thaliana DNA chromosome 4, BAC clone T20K18 (ESSA project).
GenBankAL1615340.0AL161534.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 34.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010445475.10.0PREDICTED: uncharacterized protein LOC104728144, partial
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLR0GUF40.0R0GUF4_9BRAS; Uncharacterized protein
STRINGAT4G12750.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator